PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf08263g04004.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family TALE
Protein Properties Length: 640aa    MW: 71026.4 Da    PI: 8.0392
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf08263g04004.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox27.64.9e-093864231954
                               HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
                  Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                               Fe   ++yp+ +++  LAk++gLt +qV++WF N R +
  Niben101Scf08263g04004.1 386 FEHflHPYPKDSDKIILAKQTGLTRSQVSNWFINARVR 423
                               554459******************************88 PP

2BELL114.84.3e-37249320172
                      BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                               +rqe q+kkakL+++leeV++rY+qy++q+q+++ss e+vag+gsak+Yt+lAl+aiS++FrcLkdai++qi
  Niben101Scf08263g04004.1 249 QRQEFQMKKAKLVTMLEEVEQRYRQYHHQMQIIVSSLEQVAGIGSAKSYTQLALHAISKQFRCLKDAIVGQI 320
                               699********************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005741.8E-58173318IPR006563POX domain
PfamPF075261.4E-46178317IPR006563POX domain
PROSITE profilePS5007111.855364427IPR001356Homeobox domain
CDDcd000861.99E-11367428No hitNo description
SMARTSM003892.2E-9367431IPR001356Homeobox domain
SuperFamilySSF466898.55E-17368433IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.6E-28370433IPR009057Homeodomain-like
PfamPF059201.3E-17384423IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 640 aa     Download sequence    Send to blast
MYYQGTSDNI HQAADGNIQT LYLMNPNYIH QGYSIDTQQQ QQQQHHQQQI IRHAPLQAQQ  60
HFIGVPLPAV SLHDQNHAQL IHRLWNQSGG GGGNGSHHQS QIIPSSTVVS ATSCGGRTTD  120
LASQLGFQRP MNMSPTQQQQ GGLSLSLSPQ QQISFNNISA QNQVGSNINR GLDGISSMVL  180
GSKYLKAAQE LLDEVVNVGK CIKGSELEKG ELMNKESILP LAGDGNTSNS GGESSSKQKN  240
GVAELTTAQR QEFQMKKAKL VTMLEEVEQR YRQYHHQMQI IVSSLEQVAG IGSAKSYTQL  300
ALHAISKQFR CLKDAIVGQI KAMSKSLGEE DQSLGGKIEG SRFKFVDHHL RQQRALQQIG  360
MMQPNAWRPQ RGLPERAVSV LRAWLFEHFL HPYPKDSDKI ILAKQTGLTR SQVSNWFINA  420
RVRLWKPMVE EMYLEEVKNN QEQNSSSEEN KNKNESNKEK MVSKSSAPQE NGAPTEIATS  480
TITTPPTACG SSFQAVQAHN FSFLGSLNME NCTTAKKPRN HDMHNNSPSS ILSSVEMDET  540
KARDHQSNKG FNPLMDAAAV YAMGEFGRFN PHEQMAATNF HGNNGVSLTL GLPPNSENLS  600
QQSYQNTIEF NRMSYENIDF QNKRFPSQLL PDFVAGNLGT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_B7e-16373431563Homeobox protein Meis2
3k2a_A7e-16373431563Homeobox protein Meis2
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009773899.10.0PREDICTED: BEL1-like homeodomain protein 1
RefseqXP_009773900.10.0PREDICTED: BEL1-like homeodomain protein 1
TrEMBLQ7Y0Z70.0Q7Y0Z7_SOLLC; Bell-like homeodomain protein 2
STRINGSolyc06g074120.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA14782467
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G35940.31e-107BEL1-like homeodomain 1